{"product_id":"proteintech-66767-1-ig","title":"Proteintech, 66767-1-Ig, HSP27 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSP27 (66767-1-Ig) by Proteintech is a Monoclonal antibody targeting HSP27 in WB, IHC, IF, FC (Intra), ELISA applications with reactivity to human, mouse, rat, zebrafish samples\n66767-1-Ig targets HSP27 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HeLa cells,  HSC-T6 cells,  mouse liver tissue,  U2OS cells,  A549 cells,  HepG2 cells,  HuH-7 cells\nPositive IHC detected in: human gliomas tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF detected in: zebrafish retina, MCF-7 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF): IF : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or\/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, zebrafish\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27859 Product name: Recombinant human HSPB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-205 aa of BC012768 Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK Predict reactive species\nFull Name: heat shock 27kDa protein 1\nCalculated Molecular Weight: 19-23 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC012768\nGene Symbol: HSPB1\nGene ID (NCBI): 3315\nRRID: AB_2882113\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P04792\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888029257897,"sku":"66767-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66767-1-ig","provider":"Iright","version":"1.0","type":"link"}