{"product_id":"proteintech-66774-1-ig","title":"Proteintech, 66774-1-Ig, KCNQ2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNQ2 (66774-1-Ig) by Proteintech is a Monoclonal antibody targeting KCNQ2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66774-1-Ig targets KCNQ2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25781 Product name: Recombinant human KCNQ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC000699 Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL Predict reactive species\nFull Name: potassium voltage-gated channel, KQT-like subfamily, member 2\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC000699\nGene Symbol: KCNQ2\nGene ID (NCBI): 3785\nRRID: AB_2882120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O43526\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888029814953,"sku":"66774-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66774-1-ig","provider":"Iright","version":"1.0","type":"link"}