{"product_id":"proteintech-66777-1-ig","title":"Proteintech, 66777-1-Ig, TOM20 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOM20 (66777-1-Ig) by Proteintech is a Monoclonal antibody targeting TOM20 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n66777-1-Ig targets TOM20 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  THP-1 cells,  K-562 cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, monkey, chicken, bovine\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species\nFull Name: translocase of outer mitochondrial membrane 20 homolog (yeast)\nCalculated Molecular Weight: 145 aa, 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC000882\nGene Symbol: TOM20\nGene ID (NCBI): 9804\nRRID: AB_2882123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15388\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887976370345,"sku":"66777-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66777-1-ig","provider":"Iright","version":"1.0","type":"link"}