{"product_id":"proteintech-66786-1-ig","title":"Proteintech, 66786-1-Ig, SOX10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX10 (66786-1-Ig) by Proteintech is a Monoclonal antibody targeting SOX10 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n66786-1-Ig targets SOX10 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, MDA-MB-453 cells\nPositive IHC detected in: human malignant melanoma tissue, mouse brain tissue,  rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue, mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\nPositive FC (Intra) detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, chicken\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23191 Product name: Recombinant human SOX10 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 267-466 aa of BC002824 Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP Predict reactive species\nFull Name: SRY (sex determining region Y)-box 10\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC002824\nGene Symbol: SOX10\nGene ID (NCBI): 6663\nRRID: AB_2882131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P56693\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887988134057,"sku":"66786-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66786-1-ig","provider":"Iright","version":"1.0","type":"link"}