{"product_id":"proteintech-66794-1-ig","title":"Proteintech, 66794-1-Ig, p57Kip2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe p57Kip2 (66794-1-Ig) by Proteintech is a Monoclonal antibody targeting p57Kip2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66794-1-Ig targets p57Kip2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, HCT 116 cells,  HeLa cells,  MDA-MB-231 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin\/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19927 Product name: Recombinant human CDKN1C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-316 aa of BC067842 Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR Predict reactive species\nFull Name: cyclin-dependent kinase inhibitor 1C (p57, Kip2)\nCalculated Molecular Weight: 316 aa, 32 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC067842\nGene Symbol: p57 Kip2\/CDKN1C\nGene ID (NCBI): 1028\nRRID: AB_2882138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P49918\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888001175721,"sku":"66794-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66794-1-ig","provider":"Iright","version":"1.0","type":"link"}