{"product_id":"proteintech-66797-1-ig","title":"Proteintech, 66797-1-Ig, SOCS3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOCS3 (66797-1-Ig) by Proteintech is a Monoclonal antibody targeting SOCS3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n66797-1-Ig targets SOCS3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Jurkat cells,  Ramos cells,  CTLL-2 cells,  pig spleen tissue\nPositive IHC detected in: human breast cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSuppressor of cytokine signaling 3 (SOCS3) is a member of SOCS family that these proteins induced to attenuate cytokine signal transduction in response to signals from a diverse range of cytokines and growth factors. SOCS3 is a negative regulatory protein that inhibits signaling induced by IL-6 via preventing JAK mediated activation of STAT3. However SOCS3 can positively regulate the ERK-MAPK pathway, inhibit the NF-kB pathway (PMID:26429311,25035930). In addition, SOCS3 brings a great impact on immune responses by inhibiting signaling stimulus, such as LPS, type I and type II IFNs, and IL-12. SOCS3 is widely expressed in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney (PMID: 22961088). Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer (PMID:26429311).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5386 Product name: Recombinant human SOCS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC060858 Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Predict reactive species\nFull Name: suppressor of cytokine signaling 3\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC060858\nGene Symbol: SOCS3\nGene ID (NCBI): 9021\nRRID: AB_2882141\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14543\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887988822185,"sku":"66797-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66797-1-ig","provider":"Iright","version":"1.0","type":"link"}