{"product_id":"proteintech-66798-1-ig","title":"Proteintech, 66798-1-Ig, HPGD Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HPGD (66798-1-Ig) by Proteintech is a Monoclonal antibody targeting HPGD in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n66798-1-Ig targets HPGD in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, human small intestine tissue,  Caco-2 cells,  HT-29 cells,  human colon tissue\nPositive IHC detected in: human colon tissue, human colon cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHPGD, also named as PGDH (15-hydroxyprostaglandin dehydrogenase), a prostaglandin-degrading enzyme that physiologically antagonizes COX-2 (PMID:15574495). HPGD inhibits in vivo proferation of colon cancer cells (PMID:24760190). HPGD has five isoforms with the molecular mass of 29, 21, 19, 16 and 15 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1499 Product name: Recombinant human HPGD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC018986 Sequence: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ Predict reactive species\nFull Name: hydroxyprostaglandin dehydrogenase 15-(NAD)\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC018986\nGene Symbol: HPGD\nGene ID (NCBI): 3248\nRRID: AB_2861358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15428\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888020836521,"sku":"66798-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66798-1-ig","provider":"Iright","version":"1.0","type":"link"}