{"product_id":"proteintech-66811-1-ig","title":"Proteintech, 66811-1-Ig, FFAR3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FFAR3 (66811-1-Ig) by Proteintech is a Monoclonal antibody targeting FFAR3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66811-1-Ig targets FFAR3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human adipose tissue,  HT-29 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFFAR3 (Free fatty acid receptors 3) also known as GPR41, with another GPR43 protein, both are Gai-coupled receptor activated by short-chain fatty acids (SCFAs) such as acetate, propionate, and butyrate (PMID:26870043). GPR41 protein is translated from the bicistronic mRNA encoding GPR40 and GPR41, where an internal ribosome entry site (IRES) is utilized for the GPR41 coding sequence downstream of GPR40 (PMID:22493486). GPR41 is expressed in adipose tissue, gut, and the peripheral nervous system, and it is involved in SCFA-dependent energy regulation(PMID: 24904531).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28025 Product name: Recombinant human FFAR3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 246-346 aa of BC035657 Sequence: VVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES Predict reactive species\nFull Name: free fatty acid receptor 3\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 40-48 kDa\nGenBank Accession Number: BC035657\nGene Symbol: FFAR3\nGene ID (NCBI): 2865\nRRID: AB_2882154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14843\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887990132905,"sku":"66811-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66811-1-ig","provider":"Iright","version":"1.0","type":"link"}