{"product_id":"proteintech-66818-1-ig","title":"Proteintech, 66818-1-Ig, ESRRB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESRRB (66818-1-Ig) by Proteintech is a Monoclonal antibody targeting ESRRB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66818-1-Ig targets ESRRB in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  NCCIT cells,  JAR cells,  A549 cells,  Caco-2 cells,  LNCaP cells,  HT-29 cells,  Rat brain tissue,  Mouse brain tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEstrogen related receptor beta (ESRRB), a NR3 Steroid Receptor, has been shown to affect early placental development. Also it can act as a repressor of transcriptional activity mediated by the glucocorticoid receptor (GR). It binds as a monomer to the extended half-site TNAAGTGCA and as a homodimer to the estrogen response element (ERE), palindromic thyroid hormone response element (TRE(pal)), and SF-1 response element, but not to the glucocorticoid response element (GRE). Estrogen related receptor beta mutations lead to abnormal development of the chorion and defective diploid trophoblast proliferation, and are lethal during midgestation. Expression has been documented in mice in the extra embryonic ectoderm that gives rise to the chorion. ESTs have been isolated from normal human eye, lung, and testis libraries. The ligand for the receptor is PPARgamma coactivator 1 (PGC-1) beta. ESRRB exists various isoforms and molecular weight of each isoform is 48 kDa,55 kDa and 56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18626 Product name: Recombinant human ESRRB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-91 aa of BC131517 Sequence: MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC Predict reactive species\nFull Name: estrogen-related receptor beta\nCalculated Molecular Weight: 508 aa, 56 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC131517\nGene Symbol: ESRRB\nGene ID (NCBI): 2103\nRRID: AB_2882161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O95718\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061894825,"sku":"66818-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66818-1-ig","provider":"Iright","version":"1.0","type":"link"}