{"product_id":"proteintech-66826-1-ig","title":"Proteintech, 66826-1-Ig, PPARA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPARA (66826-1-Ig) by Proteintech is a Monoclonal antibody targeting PPARA in WB, ELISA applications with reactivity to Human, rat samples\n66826-1-Ig targets PPARA in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, ROS1728 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxisome proliferator-activated receptor alpha (PPARA) is a ligand-activated transcription factor that belongs to the PPAR nuclear receptor superfamily. PPARA is essential in the modulation of lipid transport and metabolism, mainly through activating mitochondrial and peroxisomal fatty acid β-oxidation pathways. In addition, PPARA seems to decrease inflammation mainly through direct interaction with NF-κB, causing inhibition of its signaling pathway or reducing the activated levels of NF-κB and subsequent inflammation. Furthermore, PPARA was implicated in the attenuation of oxidative stress in alcoholic liver disease when treated with polyenephosphatidylcholine through downregulation of ROS-generating enzymes such as ethanol-inducible cytochrome P450 2E1 (CYP2E1), acyl-CoA oxidase, and NADPH oxidase. PPARA exists two isoforms and molecular weight of PPARA isoforms are 52 kDa and 22 kDa. The ability of a retinoid X receptor (RXR) to heterodimerize with many nuclear receptors, including LXR, PPAR, NGF1B and RAR, underscores its pivotal role within the nuclear receptor superfamily. Among these heterodimers, PPAR:RXR is considered an important signalling mediator of both PPAR ligands, such as fatty acids, and 9-cis retinoic acid (9-cis RA), an RXR ligand. (PMID: 15103326 ). PPARA can form Heterodimer with RXRA and molecular weight of Heterodimer is about 110 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nCited Reactivity: human, mouse, rat, pig, chicken, zebrafish, hamster, goat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7896 Product name: Recombinant human PPARA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC000052 Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD Predict reactive species\nFull Name: peroxisome proliferator-activated receptor alpha\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC000052\nGene Symbol: PPARA\nGene ID (NCBI): 5465\nRRID: AB_2882169\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q07869\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887971127465,"sku":"66826-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66826-1-ig","provider":"Iright","version":"1.0","type":"link"}