{"product_id":"proteintech-66830-1-ig","title":"Proteintech, 66830-1-Ig, APOE Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOE (66830-1-Ig) by Proteintech is a Monoclonal antibody targeting APOE in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n66830-1-Ig targets APOE in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue, human blood,  human plasma,  T-47D cells,  HepG2 cells,  Caco-2 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:20000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe apolipoprotein E (APOE) is a 299-amino acid polypeptide that mediates the binding, internalization, and catabolism of lipoprotein particles, and also serve as a ligand for the LDL (APO B\/E) receptor and for the specific APOE receptor (chylomicron remnant) of hepatic tissues.\nThe very strong association of the APOE ɛ4 allele with AD risk and its role in the accumulation of amyloid β in brains of people and animal models solidify the biological relevance of APOE isoforms but do not provide mechanistic insight.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28186 Product name: Recombinant human APOE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 66-317 aa of BC003557 Sequence: QEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH Predict reactive species\nFull Name: Apolipoprotein E\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 34-36 kDa\nGenBank Accession Number: BC003557\nGene Symbol: APOE\nGene ID (NCBI): 348\nRRID: AB_2882173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02649\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887985348777,"sku":"66830-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66830-1-ig","provider":"Iright","version":"1.0","type":"link"}