{"product_id":"proteintech-66889-1-ig","title":"Proteintech, 66889-1-Ig, GLUT2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLUT2 (66889-1-Ig) by Proteintech is a Monoclonal antibody targeting GLUT2 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples\n66889-1-Ig targets GLUT2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 4T1 cells, HSC-T6 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLUT2 is a member of glucose transporters or GLUTs which catalyze the glucose transport across plasma membrane. GLUT2 is selectively expressed in hepatocytes, pancreatic beta cells, and absorptive renal and intestinal epithelial cells. GLUT2 is required to maintain normal glucose homeostasis and normal function and development of the endocrine pancreas. Its absence leads to symptoms characteristic of non-insulin-dependent diabetes mellitus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14551 Product name: Recombinant human SLC2A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 2\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC060041\nGene Symbol: GLUT2\nGene ID (NCBI): 6514\nRRID: AB_2918478\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P11168\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888010809513,"sku":"66889-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66889-1-ig","provider":"Iright","version":"1.0","type":"link"}