{"product_id":"proteintech-66905-1-ig","title":"Proteintech, 66905-1-Ig, GLI1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLI1 (66905-1-Ig) by Proteintech is a Monoclonal antibody targeting GLI1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n66905-1-Ig targets GLI1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, C6 cells,  HEK-293 cells,  human testis tissue,  4T1 cells,  mouse brain tissue,  NCI-H1299 cells,  PC-3 cells,  MCF-7 cells,  MDA-MB-231 cells,  pig brain tissue,  rat brain tissue,  BxPC-3 cells,  U-251 cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLI1, also known as Glioma-associated oncogene, is a 1106 amino acid protein, which belongs to the GLI C2H2-type zinc-finger protein family. GLI1 is detected in testis and Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. GLI1 is tethered in the cytoplasm by binding to SUFU (PubMed:10806483). GLI1 is activated and translocated to the nucleus promoted by interaction with STK36 (PubMed:10806483). Phosphorylation of GLI1  by ULK3 may promote nuclear localization (PubMed:19878745). GLI1 as a transcriptional activator may regulate the transcription of specific genes during normal development (PubMed:19706761). GLI1 plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract and Mediates SHH signaling (PubMed:19706761). GLI1 plays a role in cell proliferation and differentiation via its role in SHH signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27832 Product name: Recombinant human GLI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 470-659 aa of BC013000 Sequence: NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS Predict reactive species\nFull Name: GLI family zinc finger 1\nCalculated Molecular Weight: 1106 aa, 118 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC013000\nGene Symbol: GLI1\nGene ID (NCBI): 2735\nRRID: AB_2882232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P08151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887975256233,"sku":"66905-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66905-1-ig","provider":"Iright","version":"1.0","type":"link"}