{"product_id":"proteintech-66907-1-ig","title":"Proteintech, 66907-1-Ig, TIAR Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIAR (66907-1-Ig) by Proteintech is a Monoclonal antibody targeting TIAR in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n66907-1-Ig targets TIAR in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HSC-T6 cells,  RAW 264.7 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  THP-1 cells,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIAR, also named as TIA 1 related protein, is an RNA-binding protein which is associated with apoptosis. It has been shown that mouse with disrupted TIAR gene show high levels of embryonic lethality. TIAR plays an important role in cytoplasm and nucleus where it can control translation of some specific mRNAs and activate splicing of exons with weak 5-splice sites. 66907-1-Ig detects 39 and 41 kDa bands in SDS-PAGE. Besides, TIAR also has the 28 kDa and 50 kDa proteins for TIAR exists in multiple alternative splicing forms.(PMID: 12533540, 7533298, 22851315, 8176212)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11981 Product name: Recombinant human TIAR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-252 aa of BC030025 Sequence: MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ Predict reactive species\nFull Name: TIA1 cytotoxic granule-associated RNA binding protein-like 1\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 39 and 41 kDa\nGenBank Accession Number: BC030025\nGene Symbol: TIAR\nGene ID (NCBI): 7073\nRRID: AB_2882234\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q01085\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888013037737,"sku":"66907-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66907-1-ig","provider":"Iright","version":"1.0","type":"link"}