{"product_id":"proteintech-66909-1-ig","title":"Proteintech, 66909-1-Ig, Carbonic Anhydrase 6\/CA6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Carbonic Anhydrase 6\/CA6 (66909-1-Ig) by Proteintech is a Monoclonal antibody targeting Carbonic Anhydrase 6\/CA6 in WB, ELISA applications with reactivity to human samples\n66909-1-Ig targets Carbonic Anhydrase 6\/CA6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCA6 (Carbonic anhydrase VI ) is a member of CA family proteins that play a central role in pH regulation and electrolyte balance. CA6 is also known as gustin, is a zinc-containing secreted protein which catalyzes the hydration of carbon hydroxide in saliva. CA6 is specifically expressed in the salivary gland of a number of mammalian species (PMID:28423504). The amino acid sequences are highly conserved across the species. And it was reported that decreasing of CA6 protein was associated with loss of taste and pathological morphology of taste buds (PMID: 9784398).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24274 Product name: Recombinant human CA6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-86 aa of BC034350 Sequence: QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHT Predict reactive species\nFull Name: carbonic anhydrase VI\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC034350\nGene Symbol: CA6\nGene ID (NCBI): 765\nRRID: AB_2882236\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23280\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888104624297,"sku":"66909-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66909-1-ig","provider":"Iright","version":"1.0","type":"link"}