{"product_id":"proteintech-66923-1-ig","title":"Proteintech, 66923-1-Ig, ROR1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ROR1 (66923-1-Ig) by Proteintech is a Monoclonal antibody targeting ROR1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n66923-1-Ig targets ROR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NIH\/3T3 cells,  HepG2 cells,  K-562 cells,  NCI-H1299 cells,  HEK-293 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nROR1 is a member of the RTK family of orphan receptors related to muscle-specific kinase and Trk neurotrophin receptors (PMID: 18546292). ROR1 is primarily expressed by neural crest cells during embryogenesis. High expression of ROR1 is reported in many types of malignancies and is thought to be involved in tumor growth, apoptosis, and epithelial-mesenchymal transition (PMID: 26245996). The human ROR1 gene encodes a 937 amino acid protein with an Ig-like domain, a cysteine-rich domain, a kringle domain, a tyrosine kinase domain, and a proline-rich domain. The calculated molecular weight of ROR1 is 104 kDa, but ROR1 has multiple N-glycosylation sites that generate post-translationally modified ROR1 at 130 kDa (PMID: 24752542).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14586 Product name: Recombinant human ROR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-364 aa of BC006374 Sequence: DECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRN Predict reactive species\nFull Name: receptor tyrosine kinase-like orphan receptor 1\nCalculated Molecular Weight: 937 aa, 104 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC006374\nGene Symbol: ROR1\nGene ID (NCBI): 4919\nRRID: AB_2882250\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q01973\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888032993449,"sku":"66923-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66923-1-ig","provider":"Iright","version":"1.0","type":"link"}