{"product_id":"proteintech-66941-1-ig","title":"Proteintech, 66941-1-Ig, RDM1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RDM1 (66941-1-Ig) by Proteintech is a Monoclonal antibody targeting RDM1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n66941-1-Ig targets RDM1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, HEK-293 cells,  HSC-T6 cells,  RAW 264.7 cells\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear\/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28686 Product name: Recombinant human RDM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-253 aa of BC038301 Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD Predict reactive species\nFull Name: RAD52 motif 1\nCalculated Molecular Weight: 284 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC038301\nGene Symbol: RDM1\nGene ID (NCBI): 201299\nRRID: AB_2882265\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NG50\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888318501033,"sku":"66941-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66941-1-ig","provider":"Iright","version":"1.0","type":"link"}