{"product_id":"proteintech-66946-1-ig","title":"Proteintech, 66946-1-Ig, 14-3-3E Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe 14-3-3E (66946-1-Ig) by Proteintech is a Monoclonal antibody targeting 14-3-3E in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66946-1-Ig targets 14-3-3E in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\n14-3-3 epsilon (also known as YWHAE) is a member of 14-3-3 proteins which were the first phosphoserine\/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25186 Product name: Recombinant human 14-3-3E protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC000179 Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Predict reactive species\nFull Name: tyrosine 3-monooxygenase\/tryptophan 5-monooxygenase activation protein, epsilon polypeptide\nCalculated Molecular Weight: 255 aa, 29 kDa\nObserved Molecular Weight: 28-32 kDa\nGenBank Accession Number: BC000179\nGene Symbol: 14-3-3E\nGene ID (NCBI): 7531\nRRID: AB_2882270\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P62258\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888024211625,"sku":"66946-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66946-1-ig","provider":"Iright","version":"1.0","type":"link"}