{"product_id":"proteintech-66948-1-ig","title":"Proteintech, 66948-1-Ig, TMEM119 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM119 (66948-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM119 in WB, ELISA applications with reactivity to Human, Pig, Mouse, Rat, rabbit samples\n66948-1-Ig targets TMEM119 in WB, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, rat brain tissue,  mouse brain tissue,  pig cerebellum tissue,  pig brain tissue,  rat cerebellum tissue,  mouse cerebellum tissue,  Rabbit cerebellum tissue,  Chicken brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Pig, Mouse, Rat, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG3\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26286 Product name: Recombinant human TMEM119 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species\nFull Name: transmembrane protein 119\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: NM_181724\nGene Symbol: TMEM119\nGene ID (NCBI): 338773\nRRID: AB_2882272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q4V9L6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887982497961,"sku":"66948-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66948-1-ig","provider":"Iright","version":"1.0","type":"link"}