{"product_id":"proteintech-66952-1-ig","title":"Proteintech, 66952-1-Ig, CD61 \/ Integrin beta 3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD61 \/ Integrin beta 3 (66952-1-Ig) by Proteintech is a Monoclonal antibody targeting CD61 \/ Integrin beta 3 in WB, IHC, ELISA applications with reactivity to Human samples\n66952-1-Ig targets CD61 \/ Integrin beta 3 in WB, IP, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrin beta-3, also named as CD61 and GPIIIa, is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin beta-3 recognize the sequence R-G-D in a wide array of ligands and the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin beta-3 brings about platelet\/platelet interaction through binding of soluble fibrinogen which leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Human integrin beta-3 has a calculated molecular weight of 87 kDa. As a result of glycosylation, the apparent molecular mass of integrin beta-3 is approximately 90-110 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27834 Product name: Recombinant human ITGB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 634-718 aa of BC127666 Sequence: CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD Predict reactive species\nFull Name: integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)\nCalculated Molecular Weight: 788 aa, 87 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC127666\nGene Symbol: Integrin beta 3\nGene ID (NCBI): 3690\nRRID: AB_2882275\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05106\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888009695401,"sku":"66952-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66952-1-ig","provider":"Iright","version":"1.0","type":"link"}