{"product_id":"proteintech-66957-1-ig","title":"Proteintech, 66957-1-Ig, LXN Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LXN (66957-1-Ig) by Proteintech is a Monoclonal antibody targeting LXN in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, pig, rabbit samples\n66957-1-Ig targets LXN in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, A549 cells,  HEK-293 cells,  SH-SY5Y cells,  rabbit brain tissue,  HeLa cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLatexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27922 Product name: Recombinant human LXN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-222 aa of BC005346 Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE Predict reactive species\nFull Name: latexin\nCalculated Molecular Weight: 222 aa, 26 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC005346\nGene Symbol: LXN\nGene ID (NCBI): 56925\nRRID: AB_2882280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BS40\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888290451625,"sku":"66957-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66957-1-ig","provider":"Iright","version":"1.0","type":"link"}