{"product_id":"proteintech-66959-1-ig","title":"Proteintech, 66959-1-Ig, RRAS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRAS (66959-1-Ig) by Proteintech is a Monoclonal antibody targeting RRAS in WB, ELISA applications with reactivity to Human, mouse, Rat samples\n66959-1-Ig targets RRAS in WB, ELISA applications and shows reactivity with Human, mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, PC-3 cells,  HT-29 cells,  HSC-T6 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:4000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRRAS belongs to the Ras subfamily of small G-proteins, which are frequently implicated in cell growth and differentiation.RRAS is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, Rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26564 Product name: Recombinant human RRAS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species\nFull Name: related RAS viral (r-ras) oncogene homolog\nCalculated Molecular Weight: 218 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC016318\nGene Symbol: RRAS\nGene ID (NCBI): 6237\nRRID: AB_2882282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10301\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888320303273,"sku":"66959-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66959-1-ig","provider":"Iright","version":"1.0","type":"link"}