{"product_id":"proteintech-67026-1-ig","title":"Proteintech, 67026-1-Ig, GLUD1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLUD1 (67026-1-Ig) by Proteintech is a Monoclonal antibody targeting GLUD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n67026-1-Ig targets GLUD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  L02 cells,  HuH-7 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue, mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman glutamate dehydrogenase (GDH), an enzyme central to the metabolism of glutamate, is known to exist in housekeeping and nerve tissue-specific isoforms encoded by the GLUD1 and GLUD2 genes, respectively. It catalyses the reversible inter-conversion of glutamate to alpha-ketoglutarate and ammonia, thus interconnecting amino acid and carbohydrate metabolism. GLUD1 might contribute to the formation of specific synapses in the hippocampus such as those formed by the projecting neurons of the entorhinal cortex(PMID: 22138648). GLUD1 has a calculated molecular mass of 61 kDa and an apparent molecular mass of 45-55 kDa with the 53aa transit peptide removed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6179 Product name: Recombinant human GLUD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 214-558 aa of BC040132 Sequence: FIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT Predict reactive species\nFull Name: glutamate dehydrogenase 1\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC040132\nGene Symbol: GLUD1\nGene ID (NCBI): 2746\nRRID: AB_2882341\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P00367\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888028668073,"sku":"67026-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67026-1-ig","provider":"Iright","version":"1.0","type":"link"}