{"product_id":"proteintech-67039-1-ig","title":"Proteintech, 67039-1-Ig, Flightless I Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Flightless I (67039-1-Ig) by Proteintech is a Monoclonal antibody targeting Flightless I in WB, IHC, ELISA applications with reactivity to Human,  Mouse,  Rat samples\n67039-1-Ig targets Flightless I in WB, IHC, ELISA applications and shows reactivity with Human,  Mouse,  Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  A549 cells,  NCI-H1299 cells,  Jurkat cells,  NIH\/3T3 cells,  HSC-T6 cells,  HepG2 cells,  MCF-7 cells,  NCCIT cells,  HT-1080 cells,  LNCaP cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFlightless I (FliI) is the most evolutionarily conserved member of the gelsolin superfamily of proteins which are key regulators of actin filament assembly and turnover. FliI comprises an N-terminal leucine-rich repeat (LRR) domain which is not present in other gelsolin family members, and the LRR domain may enable interactions between FliI and other molecules involved in signal transduction, thereby spatially integrating signaling and actin remodeling functions. This protein was originally found in Drosophila and participates in the embryonic development, while mammalian FliI protein was involved in the regulation of wound repair,skin barrier development. Studies recently demonstrated that FliI protein associated with colorectal cancer, hepatocellular and prostate cancer (PMID:30091651; 28498392).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26865 Product name: Recombinant human FLII protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 440-900 aa of BC025300 Sequence: DQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW Predict reactive species\nFull Name: flightless I homolog (Drosophila)\nCalculated Molecular Weight: 1269 aa, 145 kDa\nObserved Molecular Weight: 145-150 kDa\nGenBank Accession Number: BC025300\nGene Symbol: Flightless I\nGene ID (NCBI): 2314\nRRID: AB_2882353\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13045\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888042004649,"sku":"67039-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67039-1-ig","provider":"Iright","version":"1.0","type":"link"}