{"product_id":"proteintech-67043-1-ig","title":"Proteintech, 67043-1-Ig, COMMD5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe COMMD5 (67043-1-Ig) by Proteintech is a Monoclonal antibody targeting COMMD5 in WB, ELISA applications with reactivity to Human, Rat samples\n67043-1-Ig targets COMMD5 in WB, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, rat heart tissue,  MCF-7 cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative \"leucine zipper\" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18464 Product name: Recombinant human COMMD5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 4-159 aa of BC003055 Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV Predict reactive species\nFull Name: COMM domain containing 5\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC003055\nGene Symbol: COMMD5\nGene ID (NCBI): 28991\nRRID: AB_2882357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9GZQ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888026407081,"sku":"67043-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67043-1-ig","provider":"Iright","version":"1.0","type":"link"}