{"product_id":"proteintech-67047-1-ig","title":"Proteintech, 67047-1-Ig, GUK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GUK1 (67047-1-Ig) by Proteintech is a Monoclonal antibody targeting GUK1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n67047-1-Ig targets GUK1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  fetal human brain tissue,  rat brain tissue,  mouse brain tissue,  HeLa cells\nPositive IHC detected in: human thyroid cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human thyroid cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28805 Product name: Recombinant human GUK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC009914 Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA Predict reactive species\nFull Name: guanylate kinase 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22-27 kDa\nGenBank Accession Number: BC009914\nGene Symbol: GUK1\nGene ID (NCBI): 2987\nRRID: AB_2882360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16774\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888064057513,"sku":"67047-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67047-1-ig","provider":"Iright","version":"1.0","type":"link"}