{"product_id":"proteintech-67076-1-ig","title":"Proteintech, 67076-1-Ig, TFAP2A\/AP-2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFAP2A\/AP-2 (67076-1-Ig) by Proteintech is a Monoclonal antibody targeting TFAP2A\/AP-2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67076-1-Ig targets TFAP2A\/AP-2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HeLa cells,  HSC-T6 cells,  MCF-7 cells,  HepG2 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe activator protein-2 (AP-2) family of transcription factors comprises five 52-kDa isoforms (AP-2α, AP-2β, AP-2γ, AP-2δ, and AP-2ε), which share a common structure: a proline\/glutamine-rich transactivation domain in the N-terminal region and a helix-span-helix domain in the C-terminal region, which mediates dimerization and site-specific DNA binding. Depending on the cellular context, the AP-2 transcription factors are individually associated either with cell differentiation and development or with cancer progression\/regression. [PMID:21966377]  TFAP2A (AP-2-alpha) is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation [PMID:11694877]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4112 Product name: Recombinant human TFAP2A,AP-2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 79-431 aa of BC017754 Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK Predict reactive species\nFull Name: transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)\nCalculated Molecular Weight: 431 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC017754\nGene Symbol: TFAP2A\/AP-2\nGene ID (NCBI): 7020\nRRID: AB_2882384\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P05549\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887967195305,"sku":"67076-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67076-1-ig","provider":"Iright","version":"1.0","type":"link"}