{"product_id":"proteintech-67080-1-ig","title":"Proteintech, 67080-1-Ig, EPHB1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPHB1 (67080-1-Ig) by Proteintech is a Monoclonal antibody targeting EPHB1 in WB, ELISA applications with reactivity to Human, Mouse samples\n67080-1-Ig targets EPHB1 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, mouse brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPHB1, also named as EPHT2, NET, HEK6 and ELK, belongs to the protein kinase superfamily, Tyr protein kinase family, and Ephrin receptor subfamily. It is a receptor for members of the ephrin-B family. EPHB1 binds to ephrin-B1, -B2 and -B3. EPHB1 may be involved in cell-cell interactions in the nervous system. EPHB1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16347 Product name: Recombinant human EPHB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-371 aa of BC111744 Sequence: MVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCS Predict reactive species\nFull Name: EPH receptor B1\nCalculated Molecular Weight: 984 aa, 110 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC111744\nGene Symbol: EPHB1\nGene ID (NCBI): 2047\nRRID: AB_2882388\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P54762\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888061698217,"sku":"67080-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67080-1-ig","provider":"Iright","version":"1.0","type":"link"}