{"product_id":"proteintech-67088-1-ig","title":"Proteintech, 67088-1-Ig, SDC2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SDC2 (67088-1-Ig) by Proteintech is a Monoclonal antibody targeting SDC2 in WB, IHC, ELISA applications with reactivity to Human samples\n67088-1-Ig targets SDC2 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HuH-7 cells,  HepG2 cells,  A549 cells,  NCI-H1299 cells,  Jurkat cells\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. 67088-1-Ig antibody detects the 19 and 22 kDa SDC2 isoforms as well as the 48 kDa dimeric protein in SDS-PAGE.(PMID: 18803305, 23297089, 30022330, 29945573)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5739 Product name: Recombinant human SDC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-148 aa of BC049836 Sequence: SRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAA Predict reactive species\nFull Name: syndecan 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 19 kDa, 22 and 48 kDa\nGenBank Accession Number: BC049836\nGene Symbol: SDC2\nGene ID (NCBI): 6383\nRRID: AB_2882395\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P34741\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888001601705,"sku":"67088-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67088-1-ig","provider":"Iright","version":"1.0","type":"link"}