{"product_id":"proteintech-67093-1-ig","title":"Proteintech, 67093-1-Ig, RALA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RALA (67093-1-Ig) by Proteintech is a Monoclonal antibody targeting RALA in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, pig samples\n67093-1-Ig targets RALA in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, pig brain tissue,  MCF-7 cells,  HepG2 cells,  Jurkat cells,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5329 Product name: Recombinant human RALA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC039858 Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL Predict reactive species\nFull Name: v-ral simian leukemia viral oncogene homolog A (ras related)\nCalculated Molecular Weight: 206 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC039858\nGene Symbol: RALA\nGene ID (NCBI): 5898\nRRID: AB_2882398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P11233\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888073134249,"sku":"67093-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67093-1-ig","provider":"Iright","version":"1.0","type":"link"}