{"product_id":"proteintech-67112-1-ig","title":"Proteintech, 67112-1-Ig, HOXA7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXA7 (67112-1-Ig) by Proteintech is a Monoclonal antibody targeting HOXA7 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n67112-1-Ig targets HOXA7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HCT 116 cells,  HepG2 cells,  HL-60 cells,  HT-29 cells,  K-562 cells,  SMMC-7721 cells,  THP-1 cells,  ACHN cells,  SiHa cells,  NCI-H1299 cells,  HEK-293 cells,  RKO cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOX genes play a fundamental role in the development of the vertebrate central nervous system, heart, axial skeleton, limbs, gut, urogenital tract and external genitalia. The homeobox gene Hoxa-1 is transcriptionally regulated by retinoic acid (RA) and encodes a transcription factor, which has been shown to play important roles in cell differentiation and embryogenesis. Hoxa-1 is also expressed in cancers, such as mammary tumors, though it is not expressed in normal gland or in precancerous mammary tissues. At embryonic stages, Hoxa-2 is expressed in the mesenchyme and epithelial cells of palate, however its expression is restricted to the tips of the growing palatal shelves. Hoxa-2 protein is predominantly expressed in the nuclei of cells in the ventral mantle region of the developing embryo. In the developing and adult mouse spinal cord, Hoxa-2 protein may contribute to dorsal-ventral patterning and\/or to the specification of neuronal phenotype. Hoxa-7 functions as a potent transcriptional repressor and its action as such requires several domains, including both activator and repressor regions. Hoxa-7 is expressed in the fetal liver, lung, skeletal muscle, kidney, pancreas and placenta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19025 Product name: Recombinant human HOXA7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC148692 Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALH Predict reactive species\nFull Name: homeobox A7\nCalculated Molecular Weight: 230 aa, 25 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC148692\nGene Symbol: HOXA7\nGene ID (NCBI): 3204\nRRID: AB_2882416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P31268\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888029094057,"sku":"67112-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67112-1-ig","provider":"Iright","version":"1.0","type":"link"}