{"product_id":"proteintech-67116-1-ig","title":"Proteintech, 67116-1-Ig, VEGF-C Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VEGF-C (67116-1-Ig) by Proteintech is a Monoclonal antibody targeting VEGF-C in WB, IF\/ICC, ELISA applications with reactivity to human samples\n67116-1-Ig targets VEGF-C in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, T-47D cells,  NCI-H1299 cells,  A549 cells,  LNCaP cells,  HT-1080 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVEGFC is a member of the platelet-derived growth factor \/ vascular endothelial growth factor (PDGF\/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18182 Product name: Recombinant human VEGFC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-228 aa of BC035212 Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS Predict reactive species\nFull Name: vascular endothelial growth factor C\nCalculated Molecular Weight: 419 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC035212\nGene Symbol: VEGFC\nGene ID (NCBI): 7424\nRRID: AB_2882420\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P49767\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888080081065,"sku":"67116-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67116-1-ig","provider":"Iright","version":"1.0","type":"link"}