{"product_id":"proteintech-67120-1-ig","title":"Proteintech, 67120-1-Ig, INA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe INA (67120-1-Ig) by Proteintech is a Monoclonal antibody targeting INA in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67120-1-Ig targets INA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, rat cerebellum tissue,  pig brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINA, also named as Alpha internexin, is a 66 kDa intermediate filament protein which is involved in the morphogenesis of neurons. INA is mainly expressed in various kinds of central and peripheral neurons from early development and highly expressed in neurodegenerative and neuronal death cells. The MW of INA ranges from 60 kDa in human, pig and mouse to 66 kDa in rat.(PMID: 29940892, 2201753)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13655 Product name: Recombinant human INA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC006359 Sequence: MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR Predict reactive species\nFull Name: internexin neuronal intermediate filament protein, alpha\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: BC006359\nGene Symbol: INA\nGene ID (NCBI): 9118\nRRID: AB_2882423\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16352\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888286879913,"sku":"67120-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67120-1-ig","provider":"Iright","version":"1.0","type":"link"}