{"product_id":"proteintech-67143-1-ig","title":"Proteintech, 67143-1-Ig, RIAM Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RIAM (67143-1-Ig) by Proteintech is a Monoclonal antibody targeting RIAM in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse samples\n67143-1-Ig targets RIAM in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HL-60 cells,  Raji cells,  mouse brain tissue,  Jurkat cells,  Ramos cells,  Dauli cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAPBB1IP gene encodes a Rap1-GTP-interacting adapter molecule (RIAM) which is an important protein in Rap1-mediated integrin activation and adhesion. Rap1 is a small GTPase frequently activated in tumors such as melanoma and prostate cancer. RIAM is widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes. RIAM may function in the signal transduction from Ras activation to actin cytoskeletal remodeling. The observed molecular weight of RIAM is about 100 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4602 Product name: Recombinant human RIAM,APBB1IP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-172 aa of BC035636 Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP Predict reactive species\nFull Name: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein\nCalculated Molecular Weight: 666 aa, 73 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC035636\nGene Symbol: RIAM\nGene ID (NCBI): 54518\nRRID: AB_2882442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q7Z5R6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888319156393,"sku":"67143-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67143-1-ig","provider":"Iright","version":"1.0","type":"link"}