{"product_id":"proteintech-67146-1-ig","title":"Proteintech, 67146-1-Ig, RanGAP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RanGAP1 (67146-1-Ig) by Proteintech is a Monoclonal antibody targeting RanGAP1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67146-1-Ig targets RanGAP1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HeLa cells,  HEK-293 cells,  MCF-7 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells,  A549 cells,  LNCaP cells,  K-562 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26136 Product name: Recombinant human RANGAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-220 aa of BC014044 Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI Predict reactive species\nFull Name: Ran GTPase activating protein 1\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 64 kDa, 82 kDa\nGenBank Accession Number: BC014044\nGene Symbol: RANGAP1\nGene ID (NCBI): 5905\nRRID: AB_2882445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P46060\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888073363625,"sku":"67146-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67146-1-ig","provider":"Iright","version":"1.0","type":"link"}