{"product_id":"proteintech-67194-2-ig","title":"Proteintech, 67194-2-Ig, SHC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHC1 (67194-2-Ig) by Proteintech is a Monoclonal antibody targeting SHC1 in WB, ELISA applications with reactivity to human samples\n67194-2-Ig targets SHC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells, hTERT-RPE1 cells,  PANC-1 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe proto-oncogene SHC family consists of SHCA, SHCB, SHCC, and SHCD4 gene members, which can encode 7 kinds of cohesive molecules. SHC family is widely expressed and functional. The SHC1 gene is located in zone 1, region 2 of human chromosome 1. SHC1 is believed to be involved in inhibiting neuronal apoptosis and regulating the receptor tyrosine kinase pathway. SHC1 sensitizes cancer cells to the 8-Cl-cAMP treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25173 Product name: Recombinant human SHC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of NM_183001 Sequence: MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGC Predict reactive species\nFull Name: SHC (Src homology 2 domain containing) transforming protein 1\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: NM_183001\nGene Symbol: SHC1\nGene ID (NCBI): 6464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P29353\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888323645609,"sku":"67194-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67194-2-ig","provider":"Iright","version":"1.0","type":"link"}