{"product_id":"proteintech-67205-1-ig","title":"Proteintech, 67205-1-Ig, TMEM111 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM111 (67205-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM111 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67205-1-Ig targets TMEM111 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  human heart tissue,  pig heart tissue,  rat heart tissue,  mouse heart tissue,  HepG2 cells,  Jurkat cells,  HSC-T6,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species\nFull Name: transmembrane protein 111\nCalculated Molecular Weight: 261 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC022807\nGene Symbol: TMEM111\nGene ID (NCBI): 55831\nRRID: AB_2882498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9P0I2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888013103273,"sku":"67205-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67205-1-ig","provider":"Iright","version":"1.0","type":"link"}