{"product_id":"proteintech-67211-1-ig","title":"Proteintech, 67211-1-Ig, TBK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TBK1 (67211-1-Ig) by Proteintech is a Monoclonal antibody targeting TBK1 in WB, ELISA applications with reactivity to human, rat samples\n67211-1-Ig targets TBK1 in WB, IF, IP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, U2OS cells,  HepG2 cells,  Jurkat cells,  LNCaP cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28894 Product name: Recombinant human TBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 316-576 aa of BC034950 Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA Predict reactive species\nFull Name: TANK-binding kinase 1\nObserved Molecular Weight: 84 kDa\nGenBank Accession Number: BC034950\nGene Symbol: TBK1\nGene ID (NCBI): 29110\nRRID: AB_2882504\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UHD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887982563497,"sku":"67211-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67211-1-ig","provider":"Iright","version":"1.0","type":"link"}