{"product_id":"proteintech-67239-1-ig","title":"Proteintech, 67239-1-Ig, CDC27; APC3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC27; APC3 (67239-1-Ig) by Proteintech is a Monoclonal antibody targeting CDC27; APC3 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67239-1-Ig targets CDC27; APC3 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  HSC-T6 cells,  4T1 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lung cancer tissue\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2500-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDC27\/APC3 is a component of the anaphase-promoting complex (APC\/cyclosome), which is composed of eight subunits and highly conserved in eukaryotic cells. The APC\/cyclosome complex acts as a cell cycle-regulated E3 ubiquitin ligase which mediates ubiquitination and subsequent degradation of target proteins, and lead to the progression control through mitosis and the G1 phase of the cell cycle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25588 Product name: Recombinant human CDC27; APC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-830 aa of BC011656 Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF Predict reactive species\nFull Name: cell division cycle 27 homolog (S. cerevisiae)\nCalculated Molecular Weight: 92 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC011656\nGene Symbol: CDC27\nGene ID (NCBI): 996\nRRID: AB_2882518\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30260\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888107278505,"sku":"67239-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67239-1-ig","provider":"Iright","version":"1.0","type":"link"}