{"product_id":"proteintech-67257-1-ig","title":"Proteintech, 67257-1-Ig, SIRT5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIRT5 (67257-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRT5 in WB, IHC, ELISA applications with reactivity to human samples\n67257-1-Ig targets SIRT5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  L02 cells,  LNCaP cells,  K-562 cells\nPositive IHC detected in: human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in . It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, bovine\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7743 Product name: Recombinant human SIRT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-310 aa of BC000126 Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS Predict reactive species\nFull Name: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC000126\nGene Symbol: SIRT5\nGene ID (NCBI): 23408\nRRID: AB_2882530\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NXA8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888012906665,"sku":"67257-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67257-1-ig","provider":"Iright","version":"1.0","type":"link"}