{"product_id":"proteintech-67273-1-ig","title":"Proteintech, 67273-1-Ig, VANGL2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VANGL2 (67273-1-Ig) by Proteintech is a Monoclonal antibody targeting VANGL2 in WB, ELISA applications with reactivity to Human samples\n67273-1-Ig targets VANGL2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HepG2 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: hamster\nHost \/ Isotype: Mouse \/ IgG3\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16980 Product name: Recombinant human VANGL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species\nFull Name: vang-like 2 (van gogh, Drosophila)\nCalculated Molecular Weight: 521 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC103920\nGene Symbol: VANGL2\nGene ID (NCBI): 57216\nRRID: AB_2882542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9ULK5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888080015529,"sku":"67273-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67273-1-ig","provider":"Iright","version":"1.0","type":"link"}