{"product_id":"proteintech-67291-1-ig","title":"Proteintech, 67291-1-Ig, WFS1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe WFS1 (67291-1-Ig) by Proteintech is a Monoclonal antibody targeting WFS1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n67291-1-Ig targets WFS1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells,  A172 cells,  HT-29 cells,  HEK-293 cells,  C6 cells,  U-251 cells,  PC-12 cells,  Neuro-2a cells,  SW480 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWolfram syndrome protein (WFS1), also called wolframin, is a transmembrane protein, which is located primarily in the endoplasmic reticulum and its expression is induced in response to ER stress, partially through transcriptional activation. ER localization suggests that WFS1 protein has physiological functions in membrane trafficking, secretion, processing and\/or regulation of ER calcium homeostasis. It is ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations of the WFS1 gene are responsible for two hereditary diseases, autosomal recessive Wolfram syndrome and autosomal dominant low frequency sensorineural hearing loss.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25735 Product name: Recombinant human WFS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC030130 Sequence: MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA Predict reactive species\nFull Name: Wolfram syndrome 1 (wolframin)\nCalculated Molecular Weight: 890 aa, 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC030130\nGene Symbol: WFS1\nGene ID (NCBI): 7466\nRRID: AB_2882556\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O76024\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336654505,"sku":"67291-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67291-1-ig","provider":"Iright","version":"1.0","type":"link"}