{"product_id":"proteintech-67334-1-ig","title":"Proteintech, 67334-1-Ig, ACSM5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACSM5 (67334-1-Ig) by Proteintech is a Monoclonal antibody targeting ACSM5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67334-1-Ig targets ACSM5 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 4T1 cells, MDA-MB-231 cells,  rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10056 Product name: Recombinant human ACSM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-208 aa of BC016703 Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR Predict reactive species\nFull Name: acyl-CoA synthetase medium-chain family member 5\nCalculated Molecular Weight: 208 aa, 23 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC016703\nGene Symbol: ACSM5\nGene ID (NCBI): 54988\nRRID: AB_2882592\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6NUN0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888024342697,"sku":"67334-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67334-1-ig","provider":"Iright","version":"1.0","type":"link"}