{"product_id":"proteintech-67342-1-ig","title":"Proteintech, 67342-1-Ig, TRIM2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM2 (67342-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples\n67342-1-Ig targets TRIM2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse cerebellum tissue,  pig brain tissue\nPositive IHC detected in: mouse brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTripartite motif-containing 2(TRIM2) is an E3 ubiquitin ligase which directs proteasome-mediated degradation of target proteins by the ubiquitination of NEFL and phosphorylation of BCL2L11. This protein contains an N-terminal RING domain, followed by a B-box-2 domain, a coiled-coil region, and 6 C-terminal NHL repeats. TRIM2 involves in the apoptotic response to ischemia via directing degradation of BIM protein, thus has a role in neuroprotection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14637 Product name: Recombinant human TRIM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC011052 Sequence: MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD Predict reactive species\nFull Name: tripartite motif-containing 2\nCalculated Molecular Weight: 744 aa, 82 kDa\nObserved Molecular Weight: 70-85 kDa\nGenBank Accession Number: BC011052\nGene Symbol: TRIM2\nGene ID (NCBI): 23321\nRRID: AB_2882600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9C040\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888034468009,"sku":"67342-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67342-1-ig","provider":"Iright","version":"1.0","type":"link"}