{"product_id":"proteintech-67382-1-ig","title":"Proteintech, 67382-1-Ig, TUSC3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TUSC3 (67382-1-Ig) by Proteintech is a Monoclonal antibody targeting TUSC3 in WB, ELISA applications with reactivity to Human samples\n67382-1-Ig targets TUSC3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTUSC3 (tumor suppressor candidate 3), originally named N33, is a potential tumor supressor gene. Decreased expression of TUSC3 has been found in various cancers, including prostate cancer, pancreas cancer and ovary cancer. TUSC3 also known as OST3A, is identified as a part of the oligosaccharyl-transferase (OST) complex and plays a crucial role in protein N-glycosylation. TUSC3 mutations have been found in families with non-syndromic autosomal recessive mental retardation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9197 Product name: Recombinant human TUSC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-199 aa of BC010370 Sequence: KENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYS Predict reactive species\nFull Name: tumor suppressor candidate 3\nCalculated Molecular Weight: 347 aa, 40 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC010370\nGene Symbol: TUSC3\nGene ID (NCBI): 7991\nRRID: AB_2882629\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13454\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888333770921,"sku":"67382-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67382-1-ig","provider":"Iright","version":"1.0","type":"link"}