{"product_id":"proteintech-67390-1-ig","title":"Proteintech, 67390-1-Ig, Profilin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Profilin 1 (67390-1-Ig) by Proteintech is a Monoclonal antibody targeting Profilin 1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67390-1-Ig targets Profilin 1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HAP1,  HSC-T6 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  PC-12 cells,  NIH\/3T3 cells,  Neuro-2a cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HAP1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProfilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29206 Product name: Recombinant human PFN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006768 Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY Predict reactive species\nFull Name: profilin 1\nCalculated Molecular Weight: 140 aa, 15 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC006768\nGene Symbol: Profilin 1\nGene ID (NCBI): 5216\nRRID: AB_2882634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P07737\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888022704297,"sku":"67390-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67390-1-ig","provider":"Iright","version":"1.0","type":"link"}