{"product_id":"proteintech-67417-1-ig","title":"Proteintech, 67417-1-Ig, ACVR1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACVR1 (67417-1-Ig) by Proteintech is a Monoclonal antibody targeting ACVR1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Pig, Mouse, Rat samples\n67417-1-Ig targets ACVR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rat brain tissue,  NCI-H1299 cells,  mouse brain tissue,  JAR cells\nPositive IHC detected in: mouse heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine\/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Pig, Mouse, Rat\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13508 Product name: Recombinant human ACVR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 210-509 aa of BC033867 Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Predict reactive species\nFull Name: activin A receptor, type I\nCalculated Molecular Weight: 509 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC033867\nGene Symbol: ACVR1\nGene ID (NCBI): 90\nRRID: AB_2882657\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q04771\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017821865,"sku":"67417-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67417-1-ig","provider":"Iright","version":"1.0","type":"link"}