{"product_id":"proteintech-67432-1-ig","title":"Proteintech, 67432-1-Ig, Podoplanin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Podoplanin (67432-1-Ig) by Proteintech is a Monoclonal antibody targeting Podoplanin in IHC, IF-P, FC, ELISA applications with reactivity to human samples\n67432-1-Ig targets Podoplanin in WB, IHC, IF-P, FC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissue, human appendicitis tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue\nPositive FC detected in: MG-63 cells, A-253 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC): FC : 0.2 μg per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPodoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated \nLymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and\/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels. The antibody is specific to Podoplanin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17691 Product name: Recombinant human PDPN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 101-238 aa of BC022812 Sequence: TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP Predict reactive species\nFull Name: podoplanin\nCalculated Molecular Weight: 238 aa, 25 kDa\nGenBank Accession Number: BC022812\nGene Symbol: Podoplanin\nGene ID (NCBI): 10630\nRRID: AB_2882670\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86YL7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888016347305,"sku":"67432-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67432-1-ig","provider":"Iright","version":"1.0","type":"link"}