{"product_id":"proteintech-67457-1-ig","title":"Proteintech, 67457-1-Ig, ME2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ME2 (67457-1-Ig) by Proteintech is a Monoclonal antibody targeting ME2 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67457-1-Ig targets ME2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  human peripheral blood platelets,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nME2(malic enzyme 2) is also named as NAD-ME and belongs to the malic enzymes family. ME1, ME2 are important for NADPH production, lipogenesis and glutamine metabolism, but ME2 has a more profound effect. ME2 is a genome-coded mitochondrial enzyme that converts malate to pyruvate and is involved in neuronal synthesis of the neurotransmitter γ-aminobutyric acid (GABA)(PMID:15532013). This protein has 2 isoforms produced by alternative splicing with the MW of 65 kDa and 54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20741 Product name: Recombinant human ME2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 136-480 aa of BC000147 Sequence: SISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC Predict reactive species\nFull Name: malic enzyme 2, NAD(+)-dependent, mitochondrial\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 54 kDa, 65 kDa\nGenBank Accession Number: BC000147\nGene Symbol: ME2\nGene ID (NCBI): 4200\nRRID: AB_2882689\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P23368\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888067399849,"sku":"67457-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67457-1-ig","provider":"Iright","version":"1.0","type":"link"}