{"product_id":"proteintech-67458-1-ig","title":"Proteintech, 67458-1-Ig, AXIN2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AXIN2 (67458-1-Ig) by Proteintech is a Monoclonal antibody targeting AXIN2 in WB, ELISA applications with reactivity to human, rat samples\n67458-1-Ig targets AXIN2 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, HepG2 cells,  Jurkat cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:9600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAxis inhibition protein2 (AXIN2), also known as Coductin or Axil, is a multidomain scaffold protein that negatively regulate Wnt signaling. AXIN2 can directly interact  with beta-catenin and GSK3B. AXIN2 has a number of phosphorylation sites, and also can undergo poly(ADP-ribosy)lation by tankyrase TNKS and TNKS2. Poly(ADP-ribosy)lated AXIN2 then get unbiquitinated by RNF146 and leads to its degradation and subsequent activation of Wnt signaling. AXIN2 is localized in the cytoplasm and its mutation is involved in colorectal cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29291 Product name: Recombinant human AXIN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-83 aa of BC006295 Sequence: EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH Predict reactive species\nFull Name: axin 2\nCalculated Molecular Weight: 843 aa, 94 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC006295\nGene Symbol: AXIN2\nGene ID (NCBI): 8313\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y2T1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888101642409,"sku":"67458-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67458-1-ig","provider":"Iright","version":"1.0","type":"link"}